1 / 8

Janiye Kulthi Ka Hamare Jeevan Me Upyog

Horse Gram ko Kulthi kaha jata hai isko ham ankurit karke, banakar bhi kha sakte hai yeh pachan ke liye bhi upyog ki jati hai, aaiye Horse Gram Benefits me ham jante hai iske aur bhi fayde, aur adhik jankari ke liye click kare: http://hrelate.com/kulthi-benefits-in-hindi/

cshradhha
Download Presentation

Janiye Kulthi Ka Hamare Jeevan Me Upyog

An Image/Link below is provided (as is) to download presentation Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author. Content is provided to you AS IS for your information and personal use only. Download presentation by click this link. While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server. During download, if you can't get a presentation, the file might be deleted by the publisher.

E N D

Presentation Transcript


  1. Horse Gram Benefits, KulthikeSwasthVaradhakLaabh HRELATE.COM

  2. Horse Gram Benefits Ayurvedakeanusaarkulthi gram tasiraurhalketheekheswaadwalihotihai. Yehpachnemaiaasan, sharirmaipittaurraktbadatihai. Ayurvedamaiyehdalmanavsharirkeliyefaydemandmanijatihai. Yehkaitarahkiswasthsamasyakeilajmaiistemaalhotihai. To chaliyeaajiss article mai hum aapkobatatehai, Horse Gram Benefits. hrelate.com

  3. Regional Name of Horse Gram (Kulthi) Isehindimaikulthi, Bengali maikulthikalai, Tamil maikollu, Telgumaiulavaluaurguggillu, Kannada maihurule, oriyamaikolatha, Gujarat maikadthinidalkahajatahai. hrelate.com

  4. Horse Gram (Kulthi) ki Nutritional Facts Kulthimai Energy- 321  Ecals, Moisture- 12 gm, Protein- 22 gm, Fat- 0 gm, Mineral- 3 gm, Fiber- 5 gm, Carbohydrates- 57 gm, Calcium- 287 mg, Phosphorous 311 mg, Iron- 7 mg payajatahai. hrelate.com

  5. Horse Gram Benefits-MasikDharm Mai Gadbadi Jin mahilaokomasikdharmkedouranjyada bleeding hotihaiya fir aniyamitmahavarihotihaiunkeliyeiskasevanbahutlaabhkarihotahai. Ismemoujud iron sharirmai hemoglobin badatahai. hrelate.com

  6. Diabetes Control Karta Hai Iskeniyamitsevan se aapkabadahuyagulocose level samanya ho jatahai. To yadiaapko diabetes se sambandhitkoibhipareshanihai to aaj se hi iskasevanshurukar de aurmadhumehkibimari se bachiye. hrelate.com

  7. Pet kiSamasyaDurKare Pet maikide hone, kisiprakaar ka infection ya fir pet se sambandhitkisibhitarahkipareshanikokhatamkarnekeliyeyehekbahutacchaupayhai. Jinn logo ko acidity se bahutadhikpareshanihotihai, unkeliye to kulthiekbemisaalupayhai. hrelate.com

  8. Sperm Count Badaye Horse Gram Benefitskibaatkare to yehiskabahutbadafaydahai. Iskeniyamitsevankarne se sperm count me vradhhihotihai.Kulthi me calcium, phosphorus, iron and amino acid hotahai, joki sperm badnemaibahutmadadgarhotahai. Issliye jinn vyaktiko sex sambhandhitkoibhipareshani ho unkoiskasevanjarurkarnachahiye, jissekivo log apni sex life aaram se jee sake. hrelate.com

More Related