'Blast 1' presentation slideshows

Blast 1 - PowerPoint PPT Presentation

Bestfit Output

Bestfit Output

Bestfit Output. sp1_human x egr1_human October 10, 2001 10:50 .. . . . . . 526 RGSGDPGKKKQ HICHIQGCGKVYGKTSHLRAHLRWHTGERPFMCTWSYCG 575 | | | .: : | :: | : : :. | |:| |||::|| | |

★ ★ ★ ★ ★

1.22k views • 108 slides
Gapped BLAST and PSI-BLAST ? a new generation of protein database search programs

Gapped BLAST and PSI-BLAST ? a new generation of protein database search programs

Gapped BLAST and PSI-BLAST ? a new generation of protein database search programs. Presented by ??? ??? ??? ???. Outline. BLAST 1.0 BLAST 2.0 The two-hit method Gapped alignment PSI-BLAST Performance evaluation Discussion and Conclusion NCBI website. Statistical preliminaries.

★ ★ ★ ★ ★

867 views • 86 slides
Unlimited Wealth Builder Advertising System Opportunity

Unlimited Wealth Builder Advertising System Opportunity

http://UnlimitedWealthBuilderOpportunity.com Unlimited Wealth Builder's Genusity Advertising System Opportunity! JOIN AFFILIATE FREE OPPORTUNITY "Are you still looking for a company where you can make a Great In come and have Fun ?" If "YES!" is your answer, then read this:Tim Sebert, a 7 Figure Income earning distributor here in the Network Marketing Industry and along with his best friend and business partner of 14 years, Randy Thomas, are LAUNCHING their own, ONE-OF-A-KIND...Network Marketing Company. This Company is going to CHANGE the way people make money in this industry! GRAB your Position Right NOW! We've seen the media hype about beacons. We've read about proof of concepts and how they are the latest and sexiest devices to hit the Internet of Things. Beacons are here to stay.

★ ★ ★ ★ ★

221 views • 18 slides

View Blast 1 PowerPoint (PPT) presentations online in SlideServe. SlideServe has a very huge collection of Blast 1 PowerPoint presentations. You can view or download Blast 1 presentations for your school assignment or business presentation. Browse for the presentations on every topic that you want.