'Structure database' presentation slideshows

Introduction to Proteomics and Protein Structure Modeling BMI 705

Introduction to Proteomics and Protein Structure Modeling BMI 705. Kun Huang Department of Biomedical Informatics Ohio State University. Review of Protein Structure (5 min) Introduction to Proteomics (10 min) Protein Structure Database and Classification (15 min)

1.06k views • 79 slides

NCBI Structure

NCBI Structure. MMDB (Molecular Modeling Database) Cn3D Viewer CDD (Conserved Domain Database) VAST Structure Comparison (Vector Alignment Search Tool). MMDB.

982 views • 68 slides

Bioinformatics for Genomic and Proteomic data analysis

Bioinformatics for Genomic and Proteomic data analysis. -- Gene Prediction. Sequence Analysis. -- Alignment techniques (BLAST, PSI-BLAST). -- Major databases and retrieval techniques. -- Predicting Function, domains etc.

768 views • 51 slides

Bioinformatics Data Representation and Integration

Bioinformatics Data Representation and Integration. By Ngozi Oleleh. Table of Contents. Introduction to Bioinformatics Proteins and Sequences Bioinformatics Tools The databases Blast Functions Bioindexing Conclusion. What is Bioinformatics.

779 views • 45 slides

Protein threading

Protein threading. Structure is better conserved than sequence Structure can adopt a wide range of mutations. Physical forces favor certain structures. Number of folds is limited. Currently ~700 Total: 1,000 ~10,000 TIM barrel. Protein Threading. Basic premise

1.22k views • 37 slides

Protein structure prediction

Protein structure prediction. May 24, 2005 Return of Quiz#3 Writing assignments-please hand in.

781 views • 28 slides

378 views • 26 slides

Protein Structure

Protein Structure. July 2, 2006

547 views • 25 slides

Enter the following Micro-RNA sequence into the box Run MFold and look at the results

Using MFold to predict RNA secondary structure http://mfold.rna.albany.edu/?q=mfold/RNA-Folding-Form. Enter the following Micro-RNA sequence into the box Run MFold and look at the results.

346 views • 25 slides

Find A Homolog in Protein Structure Database ?

Find A Homolog in Protein Structure Database ?. Homology Modeling. YES. Secondary Structure Prediction. NO. Homology Modeling from Swiss-Model. Malate dehydrogenase (14 MDH) sequence SEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLD

366 views • 22 slides

Daniel J. Albershardt

Transplacental DNA Adduct Formation by Dibenzo[ a,l ]pyrene in Mice. Daniel J. Albershardt. Senior, Dept. of Biochemistry/Biophysics. Dr. William M. Baird Laboratory. Overview. Introduction. Methods. Summary. Polycyclic Aromatic Hydrocarbons (PAH).

392 views • 19 slides

Structure database: PDB

555 views • 7 slides