1 / 20

Supporting Scientific Collaboration Online

Supporting Scientific Collaboration Online. SCOPE Workshop at San Diego Supercomputer Center March 19-22, 2008. Workshop Structure Overview. Introductions to working with: a Problem Space an Investigative Case OERCommons Visualization tools CaseIT Planting Science

wyatt-blankenship
Download Presentation

Supporting Scientific Collaboration Online

An Image/Link below is provided (as is) to download presentation Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author. Content is provided to you AS IS for your information and personal use only. Download presentation by click this link. While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server. During download, if you can't get a presentation, the file might be deleted by the publisher.

E N D

Presentation Transcript

  1. Supporting Scientific Collaboration Online SCOPE Workshop at San Diego Supercomputer Center March 19-22, 2008

  2. Workshop Structure Overview • Introductions to working with: • a Problem Space • an Investigative Case • OERCommons • Visualization tools • CaseIT • Planting Science • 2 small group projects w/ presentations • Integrate OER, E-science, and/or Web 2.0 resources into a teaching project of your choice. • Describe ways you will build and/or teach with collaborative tools and resources.

  3. Investigations of HIV-1 Env Evolution Evolutionary Bioinformatics: Microbial analyses from sequence to structure to function to ecology SCOPE Workshop at SDSC March 19-22, 2008

  4. Life Cycle of HIV 1. Virus docks with receptors on host cell (CD4 + co-receptor) 2. Reverse transcription: viral RNA  DNA 3. Viral DNA inserts into host’s DNA 4. Viral RNA transcribed & proteins assembled 5. New virions bud from host cell, killing it

  5. HIV Virus

  6. The HIV Genome

  7. HIV env Gene

  8. gp120 V3 region sequence Nucleic Acid Sequence CTAGCAGAAGAAGAGGTAGTAATTAGATCTGCCAATTTCACAGACAATGCTAAAATCATAATAGTACAGC TGAATGCATCTGTAGAAATTAATTGTACAAGGCCCAACAACAATACAAGAAAAGGTATACATATAGGACC AGGGAGAGCATTTTATGCAACAGGAGAAATAATAGGAGATATAAGACAAGCACATTGTAACATTAGTAGA GAAAAATGGAATAATACTTTAAACCAGGTAGTTACAGAATTAAGGGAACAATTTGGGAATAAAACAATAA CCTTTAATCACTCCTCAGGAGGGGACCCAGAAATTGTAATGCACAGTTTTAATTGTGGAGGGGAATTTTT CTATTGTAAT ------------------------------------------------------------------------ Amino Acid Sequence LAEEEVVIRSANFTDNAKIIIVQLNASVEINCTRPNNNTRKGIHIGPGRAFYATGEIIGDIRQAHCNISR EKWNNTLNQVVTELREQFGNKTITFNHSSGGDPEIVMHSFNCGGEFFYCN

  9. gp 120 Structure

  10. The Markham et al.HIV-1 env Sequence Dataset • Longitudinal study of 15 HIV+ patients from Baltimore • Patients came in at 6-month intervals (“visits”) over 4-year period • Focused on the 3rd variable loop of the env gene (285 bp) • Each visit: sampled ~10 viral sequences and measured CD4 levels Rich data set for analyzing patterns of HIV evolution and their correlation with rates of T-cell decline

  11. Summary of the data set • Subjects: 15 • Number of visits: 3-9 • Number of clones per visit: 2-18 • Total number of sequences available: 666 • CD4 cell counts for each visit

  12. Possible Investigations • What is the pattern of HIV evolution within an individual? • Do the number of clones over time change in any regular way? • Do certain clones appear to survive (leave descendents) over time while other disappear (go extinct)?

  13. Possible Investigations • What is the pattern of HIV evolution within the env sequence? • Are there particular positions in the sequence that are more or less likely to mutate? • Are there different rates of synonymous (silent) and non-synonymous mutations?

  14. User Web Browser User Input Output to User Results to User User Instructions and queries Application Programs (May have varying interfaces and be written in different languages) Information Sources (May be of varying formats) Workbench Server Instructions Queries Format Translator, Query Engine and Program Driver Results Information The NCSA Information Workbench - An Architecture for Web-Based Computing NCSA Computational Biology Group

More Related